Lineage for d7csbb_ (7csb B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2457071Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255800] (14 PDB entries)
  8. 2457091Domain d7csbb_: 7csb B: [404831]
    automated match to d1qyda_
    complexed with gec, ndp

Details for d7csbb_

PDB Entry: 7csb (more details), 2 Å

PDB Description: atprr1 with nadp+ and (+)pinoresinol
PDB Compounds: (B:) Pinoresinol reductase 1

SCOPe Domain Sequences for d7csbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7csbb_ c.2.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ktrvlvvgatgyigkrivraclaeghetyvlqrpeigleiekvqlflsfkklgarivegs
fsdhqslvsavklvdvvvsamsgvhfrshnilvqlklveaikeagnvkrflpsefgmdpp
rmghalppgretfdqkmevrqaieaagipytyvvgacfaayfagnlsqmvtllppkekvn
iygdgnvkvvfadeddiakytaktlndprtlnktvnirppdnvltqlelvqiwekltgke
lektniaaqdflanieqmeiphqagighfyhifyegcltdhevgedeeasslypdvkykr
mddylrmfl

SCOPe Domain Coordinates for d7csbb_:

Click to download the PDB-style file with coordinates for d7csbb_.
(The format of our PDB-style files is described here.)

Timeline for d7csbb_: