SCOPe 2.07: Domain d7d4yb1: 7d4y B:1-114

Lineage for d7d4yb1 (7d4y B:1-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)

8. Domain d7d4yb1: 7d4y B:1-114 [404824]
   Other proteins in same PDB: d7d4ya2, d7d4ya3, d7d4yb2, d7d4yb3
   automated match to d2dexx2

Details for d7d4yb1

PDB Entry: 7d4y, 2.96 Å

PDB Description: structure of human wild-type peptidylarginine deiminase type iii (pad3)

PDB Compounds: (B:) Protein-arginine deiminase type-3

SCOPe Domain Sequences for d7d4yb1:

Sequence; same for both SEQRES and ATOM records:

>d7d4yb1 b.6.1.0 (B:1-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mslqrivrvslehptsavcvagvetlvdiygsvpegtemfevygtpgvdiyispnmergr
eradtrrwrfdatleiivvmnspsndlndshvqisyhssheplplayavlyltc

Timeline for d7d4yb1:

• d7d4yb1 is new in SCOPe 2.07-stable
  
• d7d4yb1 appears in the current release, SCOPe 2.08