Lineage for d1cj1e_ (1cj1 E:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82493Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 82494Species Human (Homo sapiens) [TaxId:9606] [55564] (10 PDB entries)
  8. 82509Domain d1cj1e_: 1cj1 E: [40480]

Details for d1cj1e_

PDB Entry: 1cj1 (more details), 3 Å

PDB Description: growth factor receptor binding protein sh2 domain (human) complexed with a phosphotyrosyl derivative

SCOP Domain Sequences for d1cj1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cj1e_ d.93.1.1 (E:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens)}
phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOP Domain Coordinates for d1cj1e_:

Click to download the PDB-style file with coordinates for d1cj1e_.
(The format of our PDB-style files is described here.)

Timeline for d1cj1e_: