SCOPe 2.07: Domain d7cpcb1: 7cpc B:2-155

Lineage for d7cpcb1 (7cpc B:2-155)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (58 species)
   not a true protein

7. Species Penaeus japonicus [TaxId:27405] [379454] (14 PDB entries)

8. Domain d7cpcb1: 7cpc B:2-155 [404794]
   Other proteins in same PDB: d7cpca2, d7cpcb2, d7cpcc2, d7cpcd2, d7cpce2, d7cpcf2
   automated match to d5wpna_
   complexed with fe, ni

Details for d7cpcb1

PDB Entry: 7cpc, 2.8 Å

PDB Description: his-mediated reversible self-assembly of ferritin nanocage with ni binding

PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d7cpcb1:

Sequence; same for both SEQRES and ATOM records:

>d7cpcb1 a.25.1.0 (B:2-155) automated matches {Penaeus japonicus [TaxId: 27405]}
asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn
ndphltklledeyleeqvdsikkigdmitklkr

Timeline for d7cpcb1:

• d7cpcb1 is new in SCOPe 2.07-stable
  
• d7cpcb1 appears in the current release, SCOPe 2.08