SCOPe 2.08: Domain d7chsl2: 7chs L:106-212

Lineage for d7chsl2 (7chs L:106-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d7chsl2: 7chs L:106-212 [404779]
   Other proteins in same PDB: d7chse_, d7chsh_, d7chsl1
   automated match to d1dn0a2
   complexed with nag

Details for d7chsl2

PDB Entry: 7chs, 2.4 Å

PDB Description: crystal structure of sars-cov-2 antibody p22a-1d1 with rbd

PDB Compounds: (L:) antibody P22A-1D1 light chain

SCOPe Domain Sequences for d7chsl2:

Sequence; same for both SEQRES and ATOM records:

>d7chsl2 b.1.1.2 (L:106-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d7chsl2:

• d7chsl2 first appeared in SCOPe 2.07