SCOPe 2.07: Domain d7cbzd1: 7cbz D:2-245

Lineage for d7cbzd1 (7cbz D:2-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries)

8. Domain d7cbzd1: 7cbz D:2-245 [404690]
   Other proteins in same PDB: d7cbza2, d7cbzb2, d7cbzc2, d7cbzd2, d7cbze_, d7cbzf1, d7cbzf2
   automated match to d4drxb1
   complexed with ca, fuo, gdp, gtp, mes, mg

Details for d7cbzd1

PDB Entry: 7cbz, 2.61 Å

PDB Description: crystal structure of t2r-ttl-a31 complex

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d7cbzd1:

Sequence; same for both SEQRES and ATOM records:

>d7cbzd1 c.32.1.1 (D:2-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d7cbzd1:

• d7cbzd1 is new in SCOPe 2.07-stable
  
• d7cbzd1 appears in the current release, SCOPe 2.08