Lineage for d1fyra_ (1fyr A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1661865Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1662016Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 1662017Species Human (Homo sapiens) [TaxId:9606] [55564] (34 PDB entries)
  8. 1662055Domain d1fyra_: 1fyr A: [40469]

Details for d1fyra_

PDB Entry: 1fyr (more details), 2.4 Å

PDB Description: dimer formation through domain swapping in the crystal structure of the grb2-sh2 ac-pyvnv complex
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1fyra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
hpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
yflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOPe Domain Coordinates for d1fyra_:

Click to download the PDB-style file with coordinates for d1fyra_.
(The format of our PDB-style files is described here.)

Timeline for d1fyra_: