Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311424] (11 PDB entries) |
Domain d7aweh_: 7awe H: [404675] Other proteins in same PDB: d7awea_, d7awed_, d7awee_, d7awef_, d7aweg_, d7awei_, d7awej_, d7awek_, d7awel_, d7awem_, d7aweo_, d7awep_, d7awer_, d7awes_, d7awet_, d7aweu_, d7awew_, d7awex_, d7awey_, d7awez_ automated match to d3unfb_ complexed with na, s5k, scn |
PDB Entry: 7awe (more details), 2.29 Å
SCOPe Domain Sequences for d7aweh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7aweh_ d.153.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ttimavefdggvvmgsdsrvsageavvnrvfdklsplheriycalsgsaadaqavadmaa yqlelhgieleepplvlaaanvvrnisykyredlsahlmvagwdqreggqvygtlggmlt rqpfaiggsgstfiygyvdaaykpgmspeecrrfttdaialamsrdgssggviylvtita agvdhrvilgnelpkfyde
Timeline for d7aweh_: