Lineage for d7aweh_ (7awe H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602601Species Human (Homo sapiens) [TaxId:9606] [311424] (11 PDB entries)
  8. 2602627Domain d7aweh_: 7awe H: [404675]
    Other proteins in same PDB: d7awea_, d7awed_, d7awee_, d7awef_, d7aweg_, d7awei_, d7awej_, d7awek_, d7awel_, d7awem_, d7aweo_, d7awep_, d7awer_, d7awes_, d7awet_, d7aweu_, d7awew_, d7awex_, d7awey_, d7awez_
    automated match to d3unfb_
    complexed with na, s5k, scn

Details for d7aweh_

PDB Entry: 7awe (more details), 2.29 Å

PDB Description: human immunoproteasome 20s particle in complex with [(1r)-2-(1- benzofuran-3-yl)-1-{[(1s,2r,4r)-7-oxabicyclo[2.2.1]heptan-2- yl]formamido}ethyl]boronic acid
PDB Compounds: (H:) Proteasome subunit beta type-9

SCOPe Domain Sequences for d7aweh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7aweh_ d.153.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttimavefdggvvmgsdsrvsageavvnrvfdklsplheriycalsgsaadaqavadmaa
yqlelhgieleepplvlaaanvvrnisykyredlsahlmvagwdqreggqvygtlggmlt
rqpfaiggsgstfiygyvdaaykpgmspeecrrfttdaialamsrdgssggviylvtita
agvdhrvilgnelpkfyde

SCOPe Domain Coordinates for d7aweh_:

Click to download the PDB-style file with coordinates for d7aweh_.
(The format of our PDB-style files is described here.)

Timeline for d7aweh_: