SCOPe 2.07: Domain d7caxc_: 7cax C:

Lineage for d7caxc_ (7cax C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [365483] (11 PDB entries)

8. Domain d7caxc_: 7cax C: [404667]
   automated match to d4iiua_
   complexed with edo, ndp

Details for d7caxc_

PDB Entry: 7cax, 1.85 Å

PDB Description: crystal structure of bacterial reductase

PDB Compounds: (C:) 3-oxoacyl-ACP reductase FabG

SCOPe Domain Sequences for d7caxc_:

Sequence, based on SEQRES records:

>d7caxc_ c.2.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 470]}
trrilvtgssrgigkaialqlakagfdvtvharsrqaeaeqvvqeiqalgqnshylmfdv
nerqtvqqileqdveqhggfygvvlnaglthdgafpaltdqdwdevistsldgfynvlkp
limpmihlrkggrivtlssvsgimgnrgqvnysaakagligatkalalelakrkitvncv
apglietemvtdevkehalkmiplqrmgqvdevasvvkflcsdeasyvtrqvisvnggli

Sequence, based on observed residues (ATOM records):

>d7caxc_ c.2.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 470]}
trrilvtgssrgigkaialqlakagfdvtvharsrqaeaeqvvqeiqalgqnshylmfdv
nerqtvqqileqdveqhggfygvvlnaglthdgafpaltdqdwdevistsldgfynvlkp
limpmihlrkggrivtlssvsgimgnrgqvnysaakagligatkalalelakrkitvncv
apglietvtdevkehalkmiplqrmgqvdevasvvkflcsdeasyvtrqvisvnggli

Timeline for d7caxc_:

• d7caxc_ is new in SCOPe 2.07-stable
  
• d7caxc_ appears in the current release, SCOPe 2.08