SCOPe 2.04: Domain d1bmba_: 1bmb A:

Lineage for d1bmba_ (1bmb A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55564] (34 PDB entries)

8. Domain d1bmba_: 1bmb A: [40466]

Details for d1bmba_

PDB Entry: 1bmb, 1.8 Å

PDB Description: grb2-sh2 domain in complex with kpfy*vnvef (pkf270-974)

PDB Compounds: (A:) protein (growth factor receptor bound protein 2)

SCOPe Domain Sequences for d1bmba_:

Sequence; same for both SEQRES and ATOM records:

>d1bmba_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
kphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq

Timeline for d1bmba_:

• d1bmba_ first appeared (with stable ids) in SCOP 1.55
  
• d1bmba_ appears in SCOPe 2.03
  
• d1bmba_ appears in SCOPe 2.05
  
• d1bmba_ appears in the current release, SCOPe 2.08