Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
Protein automated matches [190583] (3 species) not a true protein |
Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries) |
Domain d7cede_: 7ced E: [404610] Other proteins in same PDB: d7ceda_, d7cedb_, d7cedc_, d7cedd_, d7cedg_, d7cedh_, d7cedm_, d7cedn_ automated match to d4tqom_ |
PDB Entry: 7ced (more details), 1.9 Å
SCOPe Domain Sequences for d7cede_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cede_ a.137.2.1 (E:) automated matches {Methylococcus capsulatus [TaxId: 243233]} ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak tgkfvykvedi
Timeline for d7cede_: