Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (24 species) not a true protein |
Species Escherichia coli [TaxId:83333] [370657] (5 PDB entries) |
Domain d7cbeb_: 7cbe B: [404600] automated match to d2h2wa_ complexed with edo, gol, so4 |
PDB Entry: 7cbe (more details), 1.7 Å
SCOPe Domain Sequences for d7cbeb_:
Sequence, based on SEQRES records: (download)
>d7cbeb_ c.23.16.0 (B:) automated matches {Escherichia coli [TaxId: 83333]} pirvpdelpavnflreenvfvmttsrasgqeirplkvlilnlmpkkietenqflrllsns plqvdiqllridsresrntpaehlnnfycnfediqdqnfdglivtgaplglvefndvayw pqikqvlewskdhvtstlfvcwavqaalnilygipkqtrteklsgvyehhilhphalltr gfddsflaphsryadfpaalirdytdleilaeteegdaylfaskdkriafvtghpeydaq tlaqeffrdveagldpdvpynyfphndpqntpraswrshgnllftnwlnyyvyqi
>d7cbeb_ c.23.16.0 (B:) automated matches {Escherichia coli [TaxId: 83333]} pirvpdelpavnflreenvfvmttsrasgqeirplkvlilnlmpkkietenqflrllsns plqvdiqllridsretpaehlnnfycnfediqdqnfdglivtgaplglvefndvaywpqi kqvlewskdhvtstlfvcwavqaalnilygipkqtrteklsgvyehhilhphalltrgfd dsflaphsryadfpaalirdytdleilaeteegdaylfaskdkriafvtghpeydaqtla qeffrdveagldpdvpynyfphndpqntpraswrshgnllftnwlnyyvyqi
Timeline for d7cbeb_: