SCOPe 2.07: Domain d7c8qa_: 7c8q A:

Lineage for d7c8qa_ (7c8q A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
   consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
   Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
   Domain 2 has parallel beta-sheet of 4 strands, order 1234

4. Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families)

5. Family c.88.1.0: automated matches [191606] (1 protein)
   not a true family

6. Protein automated matches [191105] (6 species)
   not a true protein

7. Species Bacillus sp. [TaxId:2200762] [404520] (2 PDB entries)

8. Domain d7c8qa_: 7c8q A: [404597]
   automated match to d5k4ga_
   complexed with dsg, fmt, mg

Details for d7c8qa_

PDB Entry: 7c8q, 1.89 Å

PDB Description: blasnase-t13a with d-asn

PDB Compounds: (A:) Asparaginase

SCOPe Domain Sequences for d7c8qa_:

Sequence; same for both SEQRES and ATOM records:

>d7c8qa_ c.88.1.0 (A:) automated matches {Bacillus sp. [TaxId: 2200762]}
kkkvalittggaiasrktesgrlaagaisgpelaemcslpedvqidvypafqlpsmhitf
qhllelkqtvervfqdgsydgvvvthgtdtleetayfldltlqderpvvvtgsqrapeqq
gtdaytnirhavytacspdikgagtvvvfnerifnaryvkkvhasnlqgfdvfgfgylgi
idndkvyvyqkplkrdvhqlqrplpevdivkcyldgdgkfiraavregaagivlegvgrg
qvppnmvgdieqalhqgvyivittsaeegevyttydyagssydlakkgvilgkdydskka
rmklavllasyeegikdkfcy

Timeline for d7c8qa_:

• d7c8qa_ is new in SCOPe 2.07-stable
  
• d7c8qa_ appears in the current release, SCOPe 2.08