Lineage for d7c9da_ (7c9d A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467511Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2467512Protein automated matches [190197] (24 species)
    not a true protein
  7. 2467774Species Xenopus laevis [TaxId:8355] [404534] (2 PDB entries)
  8. 2467776Domain d7c9da_: 7c9d A: [404585]
    automated match to d1fyea_
    complexed with asp, ca

Details for d7c9da_

PDB Entry: 7c9d (more details), 1.8 Å

PDB Description: crystal structure of di-peptidase-e from xenopus laevis
PDB Compounds: (A:) Alpha-aspartyl dipeptidase

SCOPe Domain Sequences for d7c9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c9da_ c.23.16.0 (A:) automated matches {Xenopus laevis [TaxId: 8355]}
mmtmrrhlllvsnstlhgggylehcqehilkflgaqvkrvlfipyalhdrdayaktarqk
fealgygldsvhespdpvdavkkaeaifigggntfrllkalydndliaairkrvledgvp
yigssagtnvatisinttndmpivyppslkalelvpfninphyldpdgnskhmgetreqr
itqyheehdtppvlglregcfllvegdkatllgitrarlflrgknptehepghdfsfllg

SCOPe Domain Coordinates for d7c9da_:

Click to download the PDB-style file with coordinates for d7c9da_.
(The format of our PDB-style files is described here.)

Timeline for d7c9da_: