Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (24 species) not a true protein |
Species Xenopus laevis [TaxId:8355] [404534] (2 PDB entries) |
Domain d7c9da_: 7c9d A: [404585] automated match to d1fyea_ complexed with asp, ca |
PDB Entry: 7c9d (more details), 1.8 Å
SCOPe Domain Sequences for d7c9da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c9da_ c.23.16.0 (A:) automated matches {Xenopus laevis [TaxId: 8355]} mmtmrrhlllvsnstlhgggylehcqehilkflgaqvkrvlfipyalhdrdayaktarqk fealgygldsvhespdpvdavkkaeaifigggntfrllkalydndliaairkrvledgvp yigssagtnvatisinttndmpivyppslkalelvpfninphyldpdgnskhmgetreqr itqyheehdtppvlglregcfllvegdkatllgitrarlflrgknptehepghdfsfllg
Timeline for d7c9da_: