SCOPe 2.08: Domain d7cedi_: 7ced I:

Lineage for d7cedi_ (7ced I:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein automated matches [190583] (3 species)
   not a true protein

7. Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries)

8. Domain d7cedi_: 7ced I: [404583]
   Other proteins in same PDB: d7ceda_, d7cedb_, d7cedc_, d7cedd_, d7cedg_, d7cedh_, d7cedm_, d7cedn_
   automated match to d4tqom_

Details for d7cedi_

PDB Entry: 7ced, 1.9 Å

PDB Description: apo-methanol dehydrogenase (mdh) from methylococcus capsulatus (bath)

PDB Compounds: (I:) Methanol dehydrogenase [cytochrome c] subunit 2

SCOPe Domain Sequences for d7cedi_:

Sequence; same for both SEQRES and ATOM records:

>d7cedi_ a.137.2.1 (I:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedi

Timeline for d7cedi_:

• d7cedi_ first appeared in SCOPe 2.07