SCOP 1.75: Domain d1hctb_: 1hct B:

Lineage for d1hctb_ (1hct B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (34 proteins)
   Pfam PF00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (42 PDB entries)

8. Domain d1hctb_: 1hct B: [40454]
   complexed with po3

Details for d1hctb_

PDB Entry: 1hct

PDB Description: nmr structure of the human src sh2 domain complex

PDB Compounds: (B:) human src

SCOP Domain Sequences for d1hctb_:

Sequence; same for both SEQRES and ATOM records:

>d1hctb_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv
khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

Timeline for d1hctb_:

• d1hctb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hctb_ appears in SCOP 1.73
  
• d1hctb_ appears in SCOPe 2.01
  
• d1hctb_ appears in the current release, SCOPe 2.08