Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily) consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5 Domain 2 has parallel beta-sheet of 4 strands, order 1234 |
Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) |
Family c.88.1.0: automated matches [191606] (1 protein) not a true family |
Protein automated matches [191105] (6 species) not a true protein |
Species Bacillus sp. [TaxId:2200762] [404520] (2 PDB entries) |
Domain d7c8xb_: 7c8x B: [404526] automated match to d5k4ga_ complexed with asn, fmt, mg |
PDB Entry: 7c8x (more details), 1.99 Å
SCOPe Domain Sequences for d7c8xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c8xb_ c.88.1.0 (B:) automated matches {Bacillus sp. [TaxId: 2200762]} kkkvalittggaiasrktesgrlaagaisgpelaemcslpedvqidvypafqlpsmhitf qhllelkqtvervfqdgsydgvvvthgtdtleetayfldltlqderpvvvtgsqrapeqq gtdaytnirhavytacspdikgagtvvvfnerifnaryvkkvhasnlqgfdvfgfgylgi idndkvyvyqkplkrdvhqlqrplpevdivkcyldgdgkfiraavregaagivlegvgrg qvppnmvgdieqalhqgvyivittsaeegevyttydyagssydlakkgvilgkdydskka rmklavllasyeegikdkfc
Timeline for d7c8xb_: