Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries) |
Domain d7c40a_: 7c40 A: [404512] automated match to d4obea_ complexed with gdp, mg |
PDB Entry: 7c40 (more details), 2.52 Å
SCOPe Domain Sequences for d7c40a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c40a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
Timeline for d7c40a_: