SCOPe 2.08: Domain d7bnwa1: 7bnw A:2-111

Lineage for d7bnwa1 (7bnw A:2-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d7bnwa1: 7bnw A:2-111 [404500]
   Other proteins in same PDB: d7bnwa2, d7bnwb2, d7bnwc2, d7bnwd2
   automated match to d4w81a_

Details for d7bnwa1

PDB Entry: 7bnw, 2.59 Å

PDB Description: llama nanobody nb18 raised against gldl from flavobacterium jonhsoniae

PDB Compounds: (A:) nanobody nb18

SCOPe Domain Sequences for d7bnwa1:

Sequence; same for both SEQRES and ATOM records:

>d7bnwa1 b.1.1.1 (A:2-111) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesgggsvqaggslrlscaasgvpsssrvmgwfrqapgkqrefvaaiswtsgnvyya
dsvkgrftitrdnakntmylqmdslkpedtavyycnarrirfgvrvydywgqgtqvtv

Timeline for d7bnwa1:

• d7bnwa1 first appeared in SCOPe 2.07