SCOP 1.57: Domain d1a1ea_: 1a1e A:

Lineage for d1a1ea_ (1a1e A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (20 proteins)

6. Protein c-src tyrosine kinase [55556] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (12 PDB entries)

8. Domain d1a1ea_: 1a1e A: [40445]

Details for d1a1ea_

PDB Entry: 1a1e, 2.2 Å

PDB Description: c-src (sh2 domain) complexed with ace-phosphotyr-glu-(3- butylpiperidine)

SCOP Domain Sequences for d1a1ea_:

Sequence; same for both SEQRES and ATOM records:

>d1a1ea_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens)}
iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy
kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

Timeline for d1a1ea_:

• d1a1ea_ first appeared (with stable ids) in SCOP 1.55
  
• d1a1ea_ appears in SCOP 1.59
  
• d1a1ea_ appears in the current release, SCOPe 2.08