Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (28 species) not a true protein |
Species Mus musculus [TaxId:10090] [394118] (4 PDB entries) |
Domain d7b93t_: 7b93 T: [404436] Other proteins in same PDB: d7b93f1, d7b93f2, d7b93f3 automated match to d2qnwa_ complexed with 3pe, atp, cdl, ehz, fes, fmn, ndp, pc1, sf4, t2q, zn |
PDB Entry: 7b93 (more details), 3.04 Å
SCOPe Domain Sequences for d7b93t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7b93t_ a.28.1.0 (T:) automated matches {Mus musculus [TaxId: 10090]} ltldgikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfeipdi daeklmcpqeivdyiadkk
Timeline for d7b93t_:
View in 3D Domains from other chains: (mouse over for more information) d7b93f1, d7b93f2, d7b93f3, d7b93u_ |