SCOPe 2.07: Domain d7b93u_: 7b93 U:

Lineage for d7b93u_ (7b93 U:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (28 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [394118] (4 PDB entries)

8. Domain d7b93u_: 7b93 U: [404434]
   Other proteins in same PDB: d7b93f1, d7b93f2, d7b93f3
   automated match to d2qnwa_
   complexed with 3pe, atp, cdl, ehz, fes, fmn, ndp, pc1, sf4, t2q, zn

Details for d7b93u_

PDB Entry: 7b93, 3.04 Å

PDB Description: cryo-em structure of mitochondrial complex i from mus musculus inhibited by iacs-2858 at 3.0 a

PDB Compounds: (U:) acyl carrier protein, mitochondrial

SCOPe Domain Sequences for d7b93u_:

Sequence; same for both SEQRES and ATOM records:

>d7b93u_ a.28.1.0 (U:) automated matches {Mus musculus [TaxId: 10090]}
sdappltldgikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgf
eipdidaeklmcpqeivdyiadkkdvye

Timeline for d7b93u_:

• d7b93u_ is new in SCOPe 2.07-stable
  
• d7b93u_ appears in the current release, SCOPe 2.08