Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Neurospora crassa [TaxId:5141] [404421] (2 PDB entries) |
Domain d7asxa2: 7asx A:103-171 [404422] Other proteins in same PDB: d7asxa1 automated match to d1khia2 |
PDB Entry: 7asx (more details), 1.8 Å
SCOPe Domain Sequences for d7asxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7asxa2 b.40.4.0 (A:103-171) automated matches {Neurospora crassa [TaxId: 5141]} fkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgr emavdmkvv
Timeline for d7asxa2: