SCOPe 2.07: Domain d7ay6b1: 7ay6 B:88-412

Lineage for d7ay6b1 (7ay6 B:88-412)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein automated matches [190370] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187208] (37 PDB entries)

8. Domain d7ay6b1: 7ay6 B:88-412 [404416]
   Other proteins in same PDB: d7ay6b2
   automated match to d1rora_
   complexed with edo, mg, s8q, zn

Details for d7ay6b1

PDB Entry: 7ay6, 1.66 Å

PDB Description: crystal structure of the pde4d catalytic domain in complex with gebr- 41b

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d7ay6b1:

Sequence; same for both SEQRES and ATOM records:

>d7ay6b1 a.211.1.2 (B:88-412) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
vhpdaqdildtlednrewyqstipq

Timeline for d7ay6b1:

• d7ay6b1 is new in SCOPe 2.07-stable
  
• d7ay6b1 appears in the current release, SCOPe 2.08