Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein automated matches [190370] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187208] (37 PDB entries) |
Domain d7ay6b1: 7ay6 B:88-412 [404416] Other proteins in same PDB: d7ay6b2 automated match to d1rora_ complexed with edo, mg, s8q, zn |
PDB Entry: 7ay6 (more details), 1.66 Å
SCOPe Domain Sequences for d7ay6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ay6b1 a.211.1.2 (B:88-412) automated matches {Human (Homo sapiens) [TaxId: 9606]} qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl vhpdaqdildtlednrewyqstipq
Timeline for d7ay6b1: