Lineage for d6yx4b_ (6yx4 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577189Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2577190Protein automated matches [190492] (24 species)
    not a true protein
  7. 2577207Species Chloroflexus aggregans [TaxId:326427] [368976] (15 PDB entries)
  8. 2577219Domain d6yx4b_: 6yx4 B: [404386]
    automated match to d4eesa_
    complexed with 6lr, fmn, gol

Details for d6yx4b_

PDB Entry: 6yx4 (more details), 1.36 Å

PDB Description: structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) q148k variant with morpholine
PDB Compounds: (B:) Multi-sensor hybrid histidine kinase

SCOPe Domain Sequences for d6yx4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yx4b_ d.110.3.0 (B:) automated matches {Chloroflexus aggregans [TaxId: 326427]}
asgmivtdagadqpivfvnrafstitgyapnevlgrnarflqgpqtdaatvarlreaiaa
arpiqerilnyrkdgqpfwnqlsispvrdetgnvvafvgvktd

SCOPe Domain Coordinates for d6yx4b_:

Click to download the PDB-style file with coordinates for d6yx4b_.
(The format of our PDB-style files is described here.)

Timeline for d6yx4b_: