SCOP 1.73: Domain d2srca2: 2src A:146-248

Lineage for d2srca2 (2src A:146-248)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (32 proteins)
   Pfam PF00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (40 PDB entries)

8. Domain d2srca2: 2src A:146-248 [40437]
   Other proteins in same PDB: d2srca1, d2srca3
   complexed with anp

Details for d2srca2

PDB Entry: 2src, 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src, in complex with amp-pnp

PDB Compounds: (A:) tyrosine-protein kinase src

SCOP Domain Sequences for d2srca2:

Sequence; same for both SEQRES and ATOM records:

>d2srca2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

Timeline for d2srca2:

• d2srca2 first appeared (with stable ids) in SCOP 1.55, called d2src_2
  
• d2srca2 was called d2src_2 in SCOP 1.71
  
• d2srca2 appears in SCOP 1.75
  
• d2srca2 appears in the current release, SCOPe 2.08