SCOPe 2.07: Domain d6ywrb1: 6ywr B:48-153

Lineage for d6ywrb1 (6ywr B:48-153)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Chloroflexus aggregans [TaxId:326427] [368976] (15 PDB entries)

8. Domain d6ywrb1: 6ywr B:48-153 [404363]
   Other proteins in same PDB: d6ywrb2
   automated match to d4eesa_
   complexed with fmn, so4

Details for d6ywrb1

PDB Entry: 6ywr, 1.5 Å

PDB Description: structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) q148h variant (space group c2)

PDB Compounds: (B:) Multi-sensor hybrid histidine kinase

SCOPe Domain Sequences for d6ywrb1:

Sequence; same for both SEQRES and ATOM records:

>d6ywrb1 d.110.3.0 (B:48-153) automated matches {Chloroflexus aggregans [TaxId: 326427]}
asgmivtdagadqpivfvnrafstitgyapnevlgrnarflqgpqtdaatvarlreaiaa
arpiqerilnyrkdgqpfwnqlsispvrdetgnvvafvgvhtdvta

Timeline for d6ywrb1:

• d6ywrb1 is new in SCOPe 2.07-stable
  
• d6ywrb1 appears in the current release, SCOPe 2.08