Lineage for d6ztrb1 (6ztr B:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366431Domain d6ztrb1: 6ztr B:1-106 [404361]
    Other proteins in same PDB: d6ztri1, d6ztri2, d6ztrj1, d6ztrj2
    automated match to d4zfol1
    complexed with ca

Details for d6ztrb1

PDB Entry: 6ztr (more details), 2.1 Å

PDB Description: crystal structure of the anti-human p-cadherin fab cqy684 in complex with human p-cadherin(108-324)
PDB Compounds: (B:) CQY684 Fab light-chain

SCOPe Domain Sequences for d6ztrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ztrb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqtisntlawyqqkpgkapklliyaasnlqsgvps
rfsgsgsgtdftltisslqpedfatyycqqylswftfgqgtkveik

SCOPe Domain Coordinates for d6ztrb1:

Click to download the PDB-style file with coordinates for d6ztrb1.
(The format of our PDB-style files is described here.)

Timeline for d6ztrb1: