Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6ztrb1: 6ztr B:1-106 [404361] Other proteins in same PDB: d6ztri1, d6ztri2, d6ztrj1, d6ztrj2 automated match to d4zfol1 complexed with ca |
PDB Entry: 6ztr (more details), 2.1 Å
SCOPe Domain Sequences for d6ztrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ztrb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqtisntlawyqqkpgkapklliyaasnlqsgvps rfsgsgsgtdftltisslqpedfatyycqqylswftfgqgtkveik
Timeline for d6ztrb1: