Lineage for d1fmka2 (1fmk A:146-248)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1918740Protein c-src tyrosine kinase [55556] (3 species)
  7. 1918747Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)
  8. 1918756Domain d1fmka2: 1fmk A:146-248 [40436]
    Other proteins in same PDB: d1fmka1, d1fmka3

Details for d1fmka2

PDB Entry: 1fmk (more details), 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src
PDB Compounds: (A:) tyrosine-protein kinase src

SCOPe Domain Sequences for d1fmka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmka2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

SCOPe Domain Coordinates for d1fmka2:

Click to download the PDB-style file with coordinates for d1fmka2.
(The format of our PDB-style files is described here.)

Timeline for d1fmka2: