SCOP 1.71: Domain d1fmk_2: 1fmk 146-248

Lineage for d1fmk_2 (1fmk 146-248)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (31 proteins)
   Pfam 00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (40 PDB entries)

8. Domain d1fmk_2: 1fmk 146-248 [40436]
   Other proteins in same PDB: d1fmk_1, d1fmk_3

Details for d1fmk_2

PDB Entry: 1fmk, 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src

SCOP Domain Sequences for d1fmk_2:

Sequence; same for both SEQRES and ATOM records:

>d1fmk_2 d.93.1.1 (146-248) c-src tyrosine kinase {Human (Homo sapiens)}
eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

Timeline for d1fmk_2:

• d1fmk_2 first appeared (with stable ids) in SCOP 1.55
  
• d1fmk_2 appears in SCOP 1.69
  
• d1fmk_2 is called d1fmka2 in SCOP 1.73
  
• d1fmk_2 appears in the current release, SCOPe 2.08, called d1fmka2