SCOPe 2.07: Domain d6yn2b_: 6yn2 B:

Lineage for d6yn2b_ (6yn2 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Renilla reniformis [TaxId:6136] [225269] (7 PDB entries)

8. Domain d6yn2b_: 6yn2 B: [404353]
   automated match to d2psja_
   complexed with act, cei, gol, k

Details for d6yn2b_

PDB Entry: 6yn2, 1.9 Å

PDB Description: crystal structure of renilla reniformis luciferase variant rluc8- w121f/e144q in complex with a coelenteramide (the postcatalytic enzyme-product complex)

PDB Compounds: (B:) Coelenterazine h 2-monooxygenase

SCOPe Domain Sequences for d6yn2b_:

Sequence; same for both SEQRES and ATOM records:

>d6yn2b_ c.69.1.0 (B:) automated matches {Renilla reniformis [TaxId: 6136]}
tskvydpeqrkrmitgpqwwarckqmnvldsfinyydsekhaenaviflhgnatssylwr
hvvphiepvarciipdligmgksgksgngsyrlldhykyltawfellnlpkkiifvghdf
gaalafhyayehqdrikaivhmqsvvdvieswdewpdieedialikseegekmvlennff
vetvlpskimrklepeefaaylepfkekgevrrptlswpreiplvkggkpdvvqivrnyn
aylrasddlpklfiesdpgffsnaivegakkfpntefvkvkglhflqedapdemgkyiks
fvervlkne

Timeline for d6yn2b_:

• d6yn2b_ is new in SCOPe 2.07-stable
  
• d6yn2b_ appears in the current release, SCOPe 2.08