Lineage for d6yrma_ (6yrm A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443602Protein automated matches [190095] (28 species)
    not a true protein
  7. 2443908Species Thermoplasma acidophilum [TaxId:273075] [189712] (12 PDB entries)
  8. 2443949Domain d6yrma_: 6yrm A: [404346]
    automated match to d3s1xa_
    complexed with act, f6r, gol

Details for d6yrma_

PDB Entry: 6yrm (more details), 1.7 Å

PDB Description: transaldolase variant t30a from t. acidophilum in complex with d- fructose 6-phosphate schiff-base intermediate
PDB Compounds: (A:) Probable transaldolase

SCOPe Domain Sequences for d6yrma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yrma_ c.1.10.1 (A:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
mkifldtanideirtgvnwgivdgvttnpaliskeavngkkygdiireilkivdgpvsve
vvstkyegmveearkihglgdnavvkipmtedglraiktlssehintnctlvfnpiqall
aakagvtyvspfvgrlddigedgmqiidmirtifnnyiiktqilvasirnpihvlrsavi
gadvvtvpfnvlkslmkhpktdeglakfledwkkvspdgklil

SCOPe Domain Coordinates for d6yrma_:

Click to download the PDB-style file with coordinates for d6yrma_.
(The format of our PDB-style files is described here.)

Timeline for d6yrma_: