Lineage for d6zewa_ (6zew A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2418094Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2418095Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2418104Protein automated matches [190126] (2 species)
    not a true protein
  7. 2418157Species Mouse (Mus musculus) [TaxId:10090] [186850] (29 PDB entries)
  8. 2418162Domain d6zewa_: 6zew A: [404345]
    automated match to d2dyha_
    complexed with dms, qhb, so4

Details for d6zewa_

PDB Entry: 6zew (more details), 1.38 Å

PDB Description: keap1 kelch domain bound to a small molecule fragment
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d6zewa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zewa_ b.68.11.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpmn
tirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhqg
kiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmep

SCOPe Domain Coordinates for d6zewa_:

Click to download the PDB-style file with coordinates for d6zewa_.
(The format of our PDB-style files is described here.)

Timeline for d6zewa_: