SCOP 1.59: Domain d1spsb_: 1sps B:

Lineage for d1spsb_ (1sps B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (20 proteins)

6. Protein v-src tyrosine kinase [55554] (1 species)

7. Species Rous sarcoma virus, Schmidt-ruppin strain a [55555] (7 PDB entries)

8. Domain d1spsb_: 1sps B: [40434]

Details for d1spsb_

PDB Entry: 1sps, 2.7 Å

PDB Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms

SCOP Domain Sequences for d1spsb_:

Sequence; same for both SEQRES and ATOM records:

>d1spsb_ d.93.1.1 (B:) v-src tyrosine kinase {Rous sarcoma virus, Schmidt-ruppin strain a}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

Timeline for d1spsb_:

• d1spsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1spsb_ appears in SCOP 1.57
  
• d1spsb_ appears in SCOP 1.61
  
• d1spsb_ appears in the current release, SCOPe 2.08