SCOPe 2.08: Domain d6yx9l_: 6yx9 L:

Lineage for d6yx9l_ (6yx9 L:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6yx9l_: 6yx9 L: [404300]
   Other proteins in same PDB: d6yx9h_
   automated match to d3cdya_
   complexed with gol, ola, olb, zn

Details for d6yx9l_

PDB Entry: 6yx9, 2.4 Å

PDB Description: cryogenic human adiponectin receptor 2 (adipor2) at 2.4 a resolution determined by serial crystallography (ssx) using crystaldirect

PDB Compounds: (L:) V region light chain

SCOPe Domain Sequences for d6yx9l_:

Sequence; same for both SEQRES and ATOM records:

>d6yx9l_ b.1.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdiqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynaktladgvp
srfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtklein

Timeline for d6yx9l_:

• d6yx9l_ first appeared in SCOPe 2.07