SCOPe 2.07: Domain d6yxdh_: 6yxd H:

Lineage for d6yxdh_ (6yxd H:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d6yxdh_: 6yxd H: [404289]
   automated match to d3wxwh_
   complexed with gol, ola, olb, zn

Details for d6yxdh_

PDB Entry: 6yxd, 2.9 Å

PDB Description: room temperature structure of human adiponectin receptor 2 (adipor2) at 2.9 a resolution determined by serial crystallography (ssx) using crystaldirect

PDB Compounds: (H:) V region heavy chain

SCOPe Domain Sequences for d6yxdh_:

Sequence; same for both SEQRES and ATOM records:

>d6yxdh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa

Timeline for d6yxdh_:

• d6yxdh_ is new in SCOPe 2.07-stable
  
• d6yxdh_ appears in the current release, SCOPe 2.08