Lineage for d1bkl__ (1bkl -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135973Fold d.93: SH2-like [55549] (1 superfamily)
  4. 135974Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 135975Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 136147Protein v-src tyrosine kinase [55554] (1 species)
  7. 136148Species Rous sarcoma virus, Schmidt-ruppin strain a [55555] (7 PDB entries)
  8. 136152Domain d1bkl__: 1bkl - [40428]

Details for d1bkl__

PDB Entry: 1bkl (more details), 2.1 Å

PDB Description: self-associated apo src sh2 domain

SCOP Domain Sequences for d1bkl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkl__ d.93.1.1 (-) v-src tyrosine kinase {Rous sarcoma virus, Schmidt-ruppin strain a}
eewyfgkitrreseslllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptskefivtd

SCOP Domain Coordinates for d1bkl__:

Click to download the PDB-style file with coordinates for d1bkl__.
(The format of our PDB-style files is described here.)

Timeline for d1bkl__: