SCOPe 2.07: Domain d6z4ta1: 6z4t A:1-153

Lineage for d6z4ta1 (6z4t A:1-153)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
   Uniprot P02185

8. Domain d6z4ta1: 6z4t A:1-153 [404279]
   Other proteins in same PDB: d6z4ta2
   automated match to d2mgja_
   complexed with hem, oxy, q75; mutant

Details for d6z4ta1

PDB Entry: 6z4t, 1.23 Å

PDB Description: sperm whale myoglobin mutant (h64v v64a) bearing the non-canonical amino acid 2-amino-3-(thiazol-5-yl)propanoic acid as axial heme ligand

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d6z4ta1:

Sequence; same for both SEQRES and ATOM records:

>d6z4ta1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkvgvtaltalgailkkkghheaelkplaqsxatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d6z4ta1:

• d6z4ta1 is new in SCOPe 2.07-stable
  
• d6z4ta1 appears in the current release, SCOPe 2.08