SCOPe 2.07: Domain d6yxfh1: 6yxf H:1-119

Lineage for d6yxfh1 (6yxf H:1-119)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6yxfh1: 6yxf H:1-119 [404273]
   automated match to d5i4fa1
   complexed with do3, gd, ola, olb, zn

Details for d6yxfh1

PDB Entry: 6yxf, 3.03 Å

PDB Description: cryogenic human adiponectin receptor 2 (adipor2) with gd-do3 ligand determined by serial crystallography (ssx) using crystaldirect

PDB Compounds: (H:) v region heavy and light chains

SCOPe Domain Sequences for d6yxfh1:

Sequence; same for both SEQRES and ATOM records:

>d6yxfh1 b.1.1.0 (H:1-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa

Timeline for d6yxfh1:

• d6yxfh1 is new in SCOPe 2.07-stable
  
• d6yxfh1 appears in the current release, SCOPe 2.08