Lineage for d1skj__ (1skj -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (20 proteins) 
Protein v-src tyrosine kinase [55554] (1 species) Species Rous sarcoma virus, Schmidt-ruppin strain a [55555] (7 PDB entries) 
Domain d1skj__: 1skj - [40427]
Details for d1skj__
PDB Entry: 1skj (more details), 2.1 Å
PDB Description: cocrystal structure of urea-substituted phosphopeptide complex
SCOP Domain Sequences for d1skj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skj__ d.93.1.1 (-) v-src tyrosine kinase {Rous sarcoma virus, Schmidt-ruppin strain a}
eewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
SCOP Domain Coordinates for d1skj__:
Click to download the PDB-style file with coordinates for d1skj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1skj__:
- d1skj__ first appeared (with stable ids) in SCOP 1.55
- d1skj__ appears in SCOP 1.59
- d1skj__ appears in the current release, SCOPe 2.08, called d1skja_
View in 3D