Lineage for d6yk0b_ (6yk0 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2512002Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 2512031Protein automated matches [190479] (4 species)
    not a true protein
  7. 2512055Species Mus musculus [TaxId:10090] [404147] (3 PDB entries)
  8. 2512065Domain d6yk0b_: 6yk0 B: [404267]
    automated match to d1rfua_
    complexed with ags, edo, gol, pg4

Details for d6yk0b_

PDB Entry: 6yk0 (more details), 2.9 Å

PDB Description: crystal structure of mouse pyridoxal kinase in complex with atp-gamma- s
PDB Compounds: (B:) Pyridoxal kinase

SCOPe Domain Sequences for d6yk0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yk0b_ c.72.1.5 (B:) automated matches {Mus musculus [TaxId: 10090]}
ecrvlsiqshvvrgyvgnraamfplqvlgfevdavnsvqfsnhtgyahwkgqvlksqelh
elyeglkvndvnkydyvltgytrdksflamvvdivrelkqqnsrlvyvcdpvmgdkwnge
gsmyvpqdllpvyrdkvvpvadiitpnqfeaellsgrkihsqeeafevmdmlhcmgpdtv
vitssdlpssqgsdylialgsqrmrkpdgstvtqrirmemrkveavfvgtgdlfaamlla
wthkhpdnlkvacektvsamqhvlqrtircakaeagegqkpspaqlelrmvqskrdiedp
eivvqatvl

SCOPe Domain Coordinates for d6yk0b_:

Click to download the PDB-style file with coordinates for d6yk0b_.
(The format of our PDB-style files is described here.)

Timeline for d6yk0b_: