Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.5: PfkB-like kinase [82515] (3 proteins) includes a variety of carbohydrate and pyrimidine kinases |
Protein automated matches [190479] (4 species) not a true protein |
Species Mus musculus [TaxId:10090] [404147] (3 PDB entries) |
Domain d6yk1a_: 6yk1 A: [404247] automated match to d1rfua_ complexed with ags, d95, edo, gol, pg4 |
PDB Entry: 6yk1 (more details), 2.4 Å
SCOPe Domain Sequences for d6yk1a_:
Sequence, based on SEQRES records: (download)
>d6yk1a_ c.72.1.5 (A:) automated matches {Mus musculus [TaxId: 10090]} ecrvlsiqshvvrgyvgnraamfplqvlgfevdavnsvqfsnhtgyahwkgqvlksqelh elyeglkvndvnkydyvltgytrdksflamvvdivrelkqqnsrlvyvcdpvmgdkwnge gsmyvpqdllpvyrdkvvpvadiitpnqfeaellsgrkihsqeeafevmdmlhcmgpdtv vitssdlpssqgsdylialgsqrmrkpdgstvtqrirmemrkveavfvgtgdlfaamlla wthkhpdnlkvacektvsamqhvlqrtircakaeagegqkpspaqlelrmvqskrdiedp eivvqatvl
>d6yk1a_ c.72.1.5 (A:) automated matches {Mus musculus [TaxId: 10090]} ecrvlsiqshvvrgyvgnraamfplqvlgfevdavnsvqfsnhtgyahwkgqvlksqelh elyeglkvndvnkydyvltgytrdksflamvvdivrelkqqnsrlvyvcdpvmgdkgsmy vpqdllpvyrdkvvpvadiitpnqfeaellsgrkihsqeeafevmdmlhcmgpdtvvits sdlpssqgsdylialgsqrmrkpdgstvtqrirmemrkveavfvgtgdlfaamllawthk hpdnlkvacektvsamqhvlqrtircakaeagegqkpspaqlelrmvqskrdiedpeivv qatvl
Timeline for d6yk1a_: