Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (27 species) not a true protein |
Species Talaromyces verruculosus [TaxId:198730] [330334] (6 PDB entries) |
Domain d6yond_: 6yon D: [404220] automated match to d5i6sa_ complexed with nag, so4 |
PDB Entry: 6yon (more details), 2.6 Å
SCOPe Domain Sequences for d6yond_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yond_ c.1.8.3 (D:) automated matches {Talaromyces verruculosus [TaxId: 198730]} assfewfgsnesgaefgsgnipgvegtdytfpnttaiqilidagmnifrvpflmermipt emtgsldtayfegysevinyitgkgahavvdphnfgryygtpisstsdfqtfwstlacqf ksndlvifdtnneyhdmdesvvvalnqaaidgirdcgattqyifvegnaysgawtwttyn tamvnltdpsdlivyemhqyldsdgsgtsdqcvsstvgqervvdattwlqsngklgilge faggansvceeavegmldylaensdvwlgaswwsagpwwqdyiysmeppngiayesylsi letyf
Timeline for d6yond_: