SCOPe 2.07: Domain d6ywaa_: 6ywa A:

Lineage for d6ywaa_ (6ywa A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.387: STING C-terminal-like [254119] (1 superfamily)
   5 helices and 5 strands in one mixed beta-sheet, one long bent helix

4. Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families)
   Pfam PF15009, PubMed 22579474

5. Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)

6. Protein automated matches [254746] (4 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [401092] (4 PDB entries)

8. Domain d6ywaa_: 6ywa A: [404219]
   automated match to d4f5wa_
   complexed with gol, pwb

Details for d6ywaa_

PDB Entry: 6ywa, 2.31 Å

PDB Description: human ref sting in complex with 3',3'-c-[2'fdamp-2'fdam(ps)]

PDB Compounds: (A:) Stimulator of interferon genes protein

SCOPe Domain Sequences for d6ywaa_:

Sequence, based on SEQRES records:

>d6ywaa_ d.387.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
gnfnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpd
nlsmadpnirfldklpqqtgdhagikdrvysnsiyellengqragtcvleyatplqtlfa
msqysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevl
rhlrqee

Sequence, based on observed residues (ATOM records):

>d6ywaa_ d.387.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
gnfnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpd
nlsmadpnirfldklpqqtgdhagikdrvysnsiyellengqragtcvleyatplqtlfa
msqysqagfsredrleqaklfcrtlediladapesqnncrliayqessfslsqevlrhlr
qee

Timeline for d6ywaa_:

• d6ywaa_ is new in SCOPe 2.07-stable
  
• d6ywaa_ appears in the current release, SCOPe 2.08