SCOPe 2.07: Domain d6wwuk_: 6wwu K:

Lineage for d6wwuk_ (6wwu K:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186847] (22 PDB entries)

8. Domain d6wwuk_: 6wwu K: [404197]
   Other proteins in same PDB: d6wwua1, d6wwua2, d6wwub1, d6wwub2
   automated match to d3gbja_
   complexed with adp, gdp, gtp, mg, ta1

Details for d6wwuk_

PDB Entry: 6wwu, 2.7 Å

PDB Description: kif14[391-735] - adp-alfx in complex with a microtubule

PDB Compounds: (K:) Kinesin-like protein KIF14

SCOPe Domain Sequences for d6wwuk_:

Sequence; same for both SEQRES and ATOM records:

>d6wwuk_ c.37.1.0 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nsqvtvavrvrpfskrektekasqvvftngeeitvehpdmkqvysfiydvsfwsfdechp
gyasqttvyetlaaplldrafegyntclfaygqtgsgksytmmglneepgiiprfcedlf
aqiakkqtsevsyhlemsffevynekihdllvckgengqrkqplrarehpvsgpyvegls
mnvvssysdiqswlelgnkqrataatgmndkssrshsvftlvmtqtktevvegeehdhri
tsrinlvdlagsercstahssgqrlkegvsinkslltlgkvisalseqangkrvfipyre
stltwllkeslggnsktamiatvspaasnieetlstlryatqarl

Timeline for d6wwuk_:

• d6wwuk_ is new in SCOPe 2.07-stable
  
• d6wwuk_ appears in the current release, SCOPe 2.08