Lineage for d6yj8a_ (6yj8 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550319Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2550320Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2550519Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2550520Protein automated matches [191100] (15 species)
    not a true protein
  7. 2550535Species Bacillus subtilis [TaxId:224308] [404144] (4 PDB entries)
  8. 2550542Domain d6yj8a_: 6yj8 A: [404176]
    automated match to d3lqna_
    complexed with act, peg

Details for d6yj8a_

PDB Entry: 6yj8 (more details), 1.84 Å

PDB Description: darb-apo
PDB Compounds: (A:) CBS domain-containing protein YkuL

SCOPe Domain Sequences for d6yj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yj8a_ d.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
slqsdqlleatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhglig
tnmimnsifgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvende
qvfegiftrrvvlkelnkhirs

SCOPe Domain Coordinates for d6yj8a_:

Click to download the PDB-style file with coordinates for d6yj8a_.
(The format of our PDB-style files is described here.)

Timeline for d6yj8a_: