SCOPe 2.07: Domain d6yj9a_: 6yj9 A:

Lineage for d6yj9a_ (6yj9 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (15 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [404144] (4 PDB entries)

8. Domain d6yj9a_: 6yj9 A: [404157]
   automated match to d3lqna_
   complexed with 4bw, cl

Details for d6yj9a_

PDB Entry: 6yj9, 1.5 Å

PDB Description: darb in complex with 3'3'cgamp

PDB Compounds: (A:) CBS domain-containing protein YkuL

SCOPe Domain Sequences for d6yj9a_:

Sequence; same for both SEQRES and ATOM records:

>d6yj9a_ d.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
slqsdqlleatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhglig
tnmimnsifgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvende
qvfegiftrrvvlkelnkhirsl

Timeline for d6yj9a_:

• d6yj9a_ is new in SCOPe 2.07-stable
  
• d6yj9a_ appears in the current release, SCOPe 2.08