SCOPe 2.08: Domain d1lcja_: 1lcj A:

Lineage for d1lcja_ (1lcj A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein p56-lck tyrosine kinase [55552] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55553] (11 PDB entries)

8. Domain d1lcja_: 1lcj A: [40414]

Details for d1lcja_

PDB Entry: 1lcj, 1.8 Å

PDB Description: sh2 (src homology-2) domain of human p56-lck tyrosine kinase complexed with the 11 residue phosphotyrosyl peptide epqpyeeipiyl

PDB Compounds: (A:) p56==lck== tyrosine kinase

SCOPe Domain Sequences for d1lcja_:

Sequence; same for both SEQRES and ATOM records:

>d1lcja_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

Timeline for d1lcja_:

• d1lcja_ first appeared (with stable ids) in SCOP 1.55
  
• d1lcja_ appears in SCOPe 2.07