SCOPe 2.08: Domain d6wwsb1: 6wws B:1-243

Lineage for d6wwsb1 (6wws B:1-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)

8. Domain d6wwsb1: 6wws B:1-243 [404137]
   Other proteins in same PDB: d6wwsa2, d6wwsb2, d6wwsk_
   automated match to d4drxb1
   complexed with anp, gdp, gtp, mg, ta1

Details for d6wwsb1

PDB Entry: 6wws, 2.7 Å

PDB Description: kif14[391-743] - amp-pnp open state class in complex with a microtubule

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6wwsb1:

Sequence; same for both SEQRES and ATOM records:

>d6wwsb1 c.32.1.1 (B:1-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d6wwsb1:

• d6wwsb1 first appeared in SCOPe 2.07