Lineage for d6wwvb2 (6wwv B:244-429)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959756Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)
  8. 2959911Domain d6wwvb2: 6wwv B:244-429 [404134]
    Other proteins in same PDB: d6wwva1, d6wwvb1, d6wwvk_
    automated match to d3rycd2
    complexed with anp, gdp, gtp, mg, ta1

Details for d6wwvb2

PDB Entry: 6wwv (more details), 3.1 Å

PDB Description: kif14[391-735] - anp-pnp in complex with a microtubule
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6wwvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wwvb2 d.79.2.1 (B:244-429) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdat

SCOPe Domain Coordinates for d6wwvb2:

Click to download the PDB-style file with coordinates for d6wwvb2.
(The format of our PDB-style files is described here.)

Timeline for d6wwvb2: